PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.005G014100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 254aa    MW: 28714 Da    PI: 6.6091
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.005G014100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.94e-172370148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          +g W+++Ede+l+  ++ +G gtW+++a+  g++R++k+c++rw +yl
  Sobic.005G014100.1.p 23 KGLWSPDEDERLYSHITHYGVGTWSSVAELAGLKRSGKSCRLRWMNYL 70
                          678*******************************************97 PP

2Myb_DNA-binding48.42.1e-1576119146
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                           r + +++E++l+v + k+lG++ W++Ia++m+ gRt++++k++w++
  Sobic.005G014100.1.p  76 REPISKQEEDLIVSLQKLLGNR-WSAIAARMP-GRTDNEIKNYWNS 119
                           567799****************.*********.***********95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.2221874IPR017930Myb domain
SMARTSM007175.8E-122272IPR001005SANT/Myb domain
SuperFamilySSF466892.1E-2822117IPR009057Homeodomain-like
PfamPF002496.5E-152370IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-202477IPR009057Homeodomain-like
CDDcd001672.66E-102670No hitNo description
SMARTSM007179.4E-1475123IPR001005SANT/Myb domain
PROSITE profilePS5129417.47975125IPR017930Myb domain
PfamPF002492.1E-1377119IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.7E-2378126IPR009057Homeodomain-like
CDDcd001671.26E-1078118No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MERRKRAMVS DQLEQEDKKL MRKGLWSPDE DERLYSHITH YGVGTWSSVA ELAGLKRSGK  60
SCRLRWMNYL QPDLSREPIS KQEEDLIVSL QKLLGNRWSA IAARMPGRTD NEIKNYWNSR  120
IKKKLQQRMN TGGNYQSPLA VHQTAEERDA DMNTGGNPKA DLYGQAATTS EVQVHHSTTT  180
SYNNSADHPS LPHQLPLFTG QPLLDPNAAA IQNGEHTAAQ SSLDVSFSKS HERNFVEEYV  240
EFLMSLSDDL QEI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-262112525128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7278213e-76KJ727821.1 Zea mays clone pUT5773 MYB-related transcription factor (MYBR4) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002448905.11e-112hypothetical protein SORBIDRAFT_05g001215, partial
TrEMBLC5Y3I11e-112C5Y3I1_SORBI; Putative uncharacterized protein Sb05g001215 (Fragment)
STRINGSb05g001215.11e-112(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP87032545
Representative plantOGRP1976222
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.12e-53myb domain protein 61